Applications
WB, IHC Shipping Info
Blue Ice Product Type
Proteins Type1
Synthetic Properties
blocking peptide Product Subtype
Blocking Peptides Research Area
Signal Transduction Tag/Conjugate
PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS Storage
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. Test
You can block the antibody by the specific target amino acid sequence of peptide. Form & Buffer
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. Description
Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.